We invite you to familiarize yourself with our list of PDGF-AA products.
Below is a list of the details of this product.
203.00
10 ug
CH79-10
Below is a list of the details of this product.
Human
P04085
14,1 kDa
recombinants
Escherichia coli
Ambient/Room Temperature
Recombinants or rec. proteins
Greater than 95% as determined by reducing SDS-PAGE.
Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Recombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-Thr211 is expressed.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.Platelets, also called thrombocytes or cloth cells in blood and are needed to stop bleeding by clumping and clotting the blood the vessels when the an injury occurs. Teh bone marrow will produce the platelets that have no nucleus. Platelates are unique to mammals, the are curved shaped 1900nm to 3100 nm large nucleus free clothing structures.
